Skip to content
TrackPodcasts

Healing Horses with Elisha

Elisha Edwards

EN206 episodes
kidsfamilypetsanimalssciencenatural

A unique podcast solely dedicated to the natural horse.The information covered in each episode is based on thousands of success cases using natural health care,  practical wisdom, and science. Learn what horses need to live their best lives – body, mind, and spirit – and how diet, nutritional therapy, natural remedies, and holistic horse-keeping can work for your horse on all levels. Listen in to equip yourself with the knowledge you need to make informed decisions for your horse’s health with l...

Episodes (206)

54: 3 Foods to Avoid for Better Horse Health

Healing Horses with Elisha

Nov 26, 202423:55pending

53: The definition of toxicity and what it means for your horse

Healing Horses with Elisha

Nov 19, 202421:22pending

52: Guiding Horses Through Recovery Amid Financial Hardship

Healing Horses with Elisha

Nov 5, 202429:42pending

51: 3 Homeopathic remedies for horses with a cold or flu

Healing Horses with Elisha

Oct 29, 202420:51pending

50: Vitamin B6 for Horses: Benefits, Deficiencies, and Dosage

Healing Horses with Elisha

Oct 15, 202424:28pending

49: Fluid retention in horses: swollen sheaths, udders, and stocking up

Healing Horses with Elisha

Oct 8, 202418:20pending

48: 5 Signs That Your Horse Loves Their Food

Healing Horses with Elisha

Oct 1, 202415:11pending

47: 7 Signs that your horse is ready for a food change

Healing Horses with Elisha

Sep 17, 202421:31pending

46: Muscle Testing for Horses: What is it and how does it work?

Healing Horses with Elisha

Sep 10, 202428:14pending

45: The Benefits of Chaste Berry for Horses and their Hormones

Healing Horses with Elisha

Sep 3, 202425:50pending

44: The Role of Dopamine in Horses with Cushing’s Syndrome (PPID)

Healing Horses with Elisha

Aug 20, 202420:56pending

43: Cushing’s Syndrome (PPID) in Horses: What Goes Wrong?

Healing Horses with Elisha

Aug 13, 202429:21pending

42: Sweet Itch and Insect Allergies for Horses: The Holistic Approach

Healing Horses with Elisha

Aug 6, 202423:44pending

41: How Long Do I Supplement My Horse For?

Healing Horses with Elisha

Jul 30, 202420:49pending

40: Journaling for Better Horse Health

Healing Horses with Elisha

Jul 16, 202427:57pending

39: Dietary Strategies for Underweight Horses

Healing Horses with Elisha

Jul 9, 202430:53pending

38: Case Study: Cami’s comeback from Uveitis with Peggy Lindsley

Healing Horses with Elisha

Jul 2, 202455:17pending

37: Equine Recurrent Uveitis (ERU): The Holistic Approach

Healing Horses with Elisha

Jun 25, 202426:01pending

36: 5 Ways to Help Hormonal Mares Naturally

Healing Horses with Elisha

Jun 18, 202435:08pending

35: The Chemistry of Stress in Horses

Healing Horses with Elisha

Jun 11, 202434:43pending

34: Improving your Horse’s Emotional Health with Glenn Stewart

Healing Horses with Elisha

May 28, 202447:17pending

33: The 3 F’s for Horses and their Health

Healing Horses with Elisha

May 21, 202429:23pending

32: Using homeopathy to finish the case

Healing Horses with Elisha

May 14, 202417:13pending

31: How and when to supplement your horse with selenium

Healing Horses with Elisha

May 7, 202425:00pending

30: Case study on low thyroid and Insulin Resistance (IR) for Horses

Healing Horses with Elisha

Apr 30, 202424:44pending

29: The #1 Way to Promote Prevention & Recovery from Equine Metabolic Syndrome (...

Healing Horses with Elisha

Apr 23, 202420:30pending

28: The 3 Most Common Mistakes that could be hindering your horse’s recovery fro...

Healing Horses with Elisha

Apr 16, 202431:35pending

27: What is the best approach for your horse when it comes to Equine Metabolic S...

Healing Horses with Elisha

Apr 9, 202425:32pending

26: Guidelines to Feeding Supplements for Horses

Healing Horses with Elisha

Apr 2, 202434:48pending

25: The importance of fibre for horses

Healing Horses with Elisha

Mar 26, 202422:06pending

24: Liver Health for Horses

Healing Horses with Elisha

Mar 19, 202433:18pending

23: Why exercise is essential for better horse health

Healing Horses with Elisha

Mar 12, 202420:57pending

22: The 3 Biggest mistakes I’ve made that taught me the most about horse health

Healing Horses with Elisha

Mar 5, 202419:53pending

21: Leaky Gut in Horses: The Holistic Approach

Healing Horses with Elisha

Feb 27, 202429:20pending

20: The Benefits of Vitamin C for Horses and their Hooves

Healing Horses with Elisha

Feb 20, 202427:35pending

19: 5 Healthy Food Options that your Horse will Love

Healing Horses with Elisha

Feb 13, 202423:13pending

18: Picky Horses: What they want you to know

Healing Horses with Elisha

Feb 6, 202418:44pending

17: Protein Deficiencies in Horses: Signs, Symptoms, and Causes

Healing Horses with Elisha

Jan 30, 202424:35pending

16: Feeding Alfalfa to Horses: What you should know

Healing Horses with Elisha

Jan 23, 202420:35pending

15: Homeopathic Arnica for Horses

Healing Horses with Elisha

Jan 16, 202422:33pending

14: Homeopathy for Horses

Healing Horses with Elisha

Jan 9, 202425:02pending

13: How to set expectations for your horse’s health journey

Healing Horses with Elisha

Jan 2, 202448:03pending

12: In Crisis and Calm: Lead your Horse to Better Health in 2024 with Dr. Lizzie...

Healing Horses with Elisha

Dec 26, 202351:20pending

11: Probiotics and Hindgut Health for Horses

Healing Horses with Elisha

Dec 19, 202327:16pending

10: The Equine Microbiome

Healing Horses with Elisha

Dec 12, 202330:15pending

09: Licorice Root for Horses

Healing Horses with Elisha

Dec 5, 202324:49pending

08: 3 Reasons to Include Herbs & Plants in your Horse’s Health Program

Healing Horses with Elisha

Nov 28, 202328:29pending

07: The Fall Flare Up

Healing Horses with Elisha

Nov 21, 202323:01pending

06: Horses and Healing Layers

Healing Horses with Elisha

Nov 14, 202326:02pending

05: Will Your Horse Benefit from a Magnesium Supplement?

Healing Horses with Elisha

Nov 7, 202330:41pending